PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold05385-abinit-gene-0.4-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family SRS
Protein Properties Length: 374aa    MW: 42230.3 Da    PI: 8.7452
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold05385-abinit-gene-0.4-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70225.53.8e-084280543
                                                DUF702  5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstW 43
                                                          + +Cq CGn a+  C ++ C+ CC      C  hv    
  augustus_masked-scaffold05385-abinit-gene-0.4-mRNA-1 42 KPKCQICGNVARSRCPFKSCKSCCSRDQNPCPIHVLKAN 80
                                                          569*********************99999*****95443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.9E-644115IPR007818Protein of unknown function DUF702
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MAATSPALTN NNNNNTTTTT TTATNMAHRT DTPPKTLRGL NKPKCQICGN VARSRCPFKS  60
CKSCCSRDQN PCPIHVLKAN ATIPDKAPNS STSMFDHQGT EASPSGSAHR VASYRQLSNT  120
FSQFNNVQIP IRSRKPLTRK DAAVINEWRF SKIKEFKDRN FEVENEAFDR YMQNISLLEE  180
VFSMKSILER SNGDEPTISN PNPTSTEDNT ELMVSGLKLQ LRSNSIRTDS FRRRVQQIVD  240
RGLKKLQKRD LDDGNKDRSG QDESHEGPKR AKILKPERAL AVSDLIDKLN KARTEEDLKS  300
CIDMKLQIFN QNTISNQTEI EDAAPKDQNP KTDLEPRKES LFSSKKIIST TELDQETLNR  360
IDAHFSTIEQ IEDL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1242248LKKLQKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008373623.11e-169PREDICTED: uncharacterized protein LOC103436947
TrEMBLM5W9K11e-160M5W9K1_PRUPE; Uncharacterized protein
STRINGVIT_02s0012g00300.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF76901618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32730.12e-99